GFI1 antibody
-
- Target See all GFI1 Antibodies
- GFI1 (Growth Factor Independent 1 (GFI1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GFI1 antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC)
- Brand
- Picoband™
- Sequence
- NLITHSRKHT GFKPFGCDLC GKGFQRKVDL RRHRETQH
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for GFI1 detection. Tested with IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).
- Top Product
- Discover our top product GFI1 Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- GFI1 (Growth Factor Independent 1 (GFI1))
- Alternative Name
- GFI1 (GFI1 Products)
- Synonyms
- AW495828 antibody, Gfi-1 antibody, Pal-1 antibody, Pal1 antibody, GFI1 antibody, GFI-1 antibody, GFI1A antibody, SCN2 antibody, ZNF163 antibody, growth factor independent 1 antibody, growth factor independent 1 transcriptional repressor antibody, Gfi1 antibody, GFI1 antibody
- Background
-
Synonyms: Zinc finger protein Gfi-1, Growth factor independent protein 1, Zinc finger protein 163, GFI1, ZNF163
Background: Zinc finger protein Gfi-1 is a protein that in humans is encoded by the GFI1 gene. This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.
- UniProt
- Q99684
-