FZD4 antibody

Catalog No. ABIN5693200

Product Details anti-FZD4 Antibody

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Brand: Picoband™

Sequence: QNLGYNVTKM PNLVGHELQT DAELQLTTFT PLIQY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Frizzled 4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

References for anti-FZD4 antibody (ABIN5693200)

Bychkov, Kirichenko, Shulepko, Mikhaylova, Kirpichnikov, Lyukmanova: "Mambalgin-2 Inhibits Growth, Migration, and Invasion of Metastatic Melanoma Cells by Targeting the Channels Containing an ASIC1a Subunit Whose Up-Regulation Correlates with Poor Survival Prognosis." in: Biomedicines, Vol. 9, Issue 10, (2021) (PubMed).

Target Details for FZD4

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Alternative Name: FZD4 (FZD4 Products)

Synonyms: CG4626 antibody, DFz4 antibody, Dfz4 antibody, Dm Fz4 antibody, Dmel\\CG4626 antibody, Fz4 antibody, anon-WO0170980.10 antibody, anon-WO0170980.11 antibody, fz1 antibody, zg01 antibody, CD344 antibody, EVR1 antibody, FEVR antibody, FZD4S antibody, Fz-4 antibody, FzE4 antibody, GPCR antibody, hFz4 antibody, frizzled4 antibody, fz4 antibody, FZ-4 antibody, frizzled 4 antibody, frizzled class receptor 4 antibody, frizzled-4 antibody, frizzled class receptor 4 S homeolog antibody, fz4 antibody, fzd4 antibody, Tsp_10376 antibody, FZD4 antibody, Fzd4 antibody, fzd4.S antibody

Background:

Synonyms: Frizzled-4, Fz-4, hFz4, FzE4, CD344, FZD4

Tissue Specificity: Almost ubiquitous. Largely expressed in adult heart, skeletal muscle, ovary, and fetal kidney. Moderate amounts in adult liver, kidney, pancreas, spleen, and fetal lung, and small amounts in placenta, adult lung, prostate, testis, colon, fetal brain and liver.

Background: Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Pathways: WNT Signaling, Hormone Transport, Sensory Perception of Sound