LMO2 antibody

Catalog No. ABIN5693241

Product Details anti-LMO2 Antibody

Target: LMO2 (LIM Domain Only 2 (Rhombotin-Like 1) (LMO2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LMO2 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: QKHFCVGDRY LLINSDIVCE QDIYEWTKIN GMI

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for LMO2 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human LMO2 (QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot,0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for LMO2

Target: LMO2 (LIM Domain Only 2 (Rhombotin-Like 1) (LMO2))

Alternative Name: LMO2 (LMO2 Products)

Synonyms: Rbtn-2 antibody, Rbtn2 antibody, Rhom-2 antibody, Ttg2 antibody, RBTN2 antibody, RBTNL1 antibody, RHOM2 antibody, TTG2 antibody, wu:fc83a08 antibody, zgc:111930 antibody, LMO-2 antibody, lmo2-A antibody, xlmo2 antibody, rhombotin-2 antibody, LIM domain only 2 antibody, LIM domain only 2 (rhombotin-like 1) antibody, LIM domain only 2 S homeolog antibody, lmo2 antibody, LMO2 antibody, Lmo2 antibody, lmo2.S antibody

Background:

Synonyms: Rhombotin-2, Cysteine-rich protein TTG-2, LIM domain only protein 2, LMO-2, T-cell translocation protein 2, LMO2, RBTN2, RBTNL1, RHOM2, TTG2

Background: LIM domain only 2 (rhombotin-like 1), also known as LMO2, RBTNL1, RBTN2, RHOM2, LIM Domain Only Protein 2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.

UniProt: P25791

Pathways: Chromatin Binding