NPC2 antibody

Catalog No. ABIN5693246

Product Details anti-NPC2 Antibody

Target: NPC2 (Niemann-Pick Disease, Type C2 (NPC2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPC2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Brand: Picoband™

Sequence: KSEYPSIKLV VEWQLQDDKN QSLFCWEIPV QIVS

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Niemann Pick C2 detection. Tested with WB, IHC-P in Human.

Immunogen: A synthetic peptide corresponding to a sequence of human Niemann Pick C2 (KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot,0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section),0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for NPC2

Target: NPC2 (Niemann-Pick Disease, Type C2 (NPC2))

Alternative Name: NPC2 (NPC2 Products)

Synonyms: 2700012J19Rik antibody, AA408070 antibody, AU045843 antibody, HE1 antibody, EDDM1 antibody, re1 antibody, CE1 antibody, EPI-1 antibody, cb292 antibody, sb:cb292 antibody, NPC intracellular cholesterol transporter 2 antibody, Niemann-Pick disease, type C2 antibody, Npc2 antibody, NPC2 antibody, npc2 antibody

Background:

Synonyms: Epididymal secretory protein E1, Human epididymis-specific protein 1, He1, Niemann-Pick disease type C2 protein, NPC2, HE1

Tissue Specificity: Epididymis.

Background: NPC2 is a protein associated with Niemann-Pick disease, type C. This gene is mapped to chromosome 14q24.3. It encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.

UniProt: P61916

Pathways: SARS-CoV-2 Protein Interactome