MST1 antibody

Catalog No. ABIN5693273

Product Details anti-MST1 Antibody

Target: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MST1 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: QRSPLNDFQV LRGTELQHLL HAVVPGPWQE DVADAEE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for MST1 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human MST1 (QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEE).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for MST1

Target: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Alternative Name: MST1 (MST1 Products)

Synonyms: D3F15S2 antibody, DNF15S2 antibody, HGFL antibody, MSP antibody, NF15S2 antibody, E2F2 antibody, D3F15S2h antibody, D9H3F15S2 antibody, DNF15S2h antibody, Hgfl antibody, HGF1/MSP antibody, E1A antibody, XHL antibody, d3f15s2 antibody, dnf15s2 antibody, hgfl antibody, msp antibody, mst1 antibody, nf15s2 antibody, macrophage stimulating 1 antibody, macrophage stimulating 1 (hepatocyte growth factor-like) antibody, serine/threonine kinase 4 antibody, macrophage stimulating 1 L homeolog antibody, MST1 antibody, Mst1 antibody, STK4 antibody, mst1.L antibody

Background:

Synonyms: Hepatocyte growth factor-like protein, Macrophage stimulatory protein, Macrophage-stimulating protein, MSP, Hepatocyte growth factor-like protein alpha chain, Hepatocyte growth factor-like protein beta chain, MST1, D3F15S2, DNF15S2, HGFL

Background: Macrophage-stimulating protein (MSP), also known as HLP, HGFL, or HGFLP, is a protein that in humans is encoded by the MST1 gene. The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.

UniProt: P26927