RECK antibody

Catalog No. ABIN5693308

Product Details anti-RECK Antibody

Target: RECK (Reversion-Inducing-Cysteine-Rich Protein with Kazal Motifs (RECK))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RECK antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: NAQSDQGAMN DMKLWEKGSI KMPFINIPVL DIKKCQPEMW KAIA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for RECK detection. Tested with WB in Human,Mouse.

Immunogen: A synthetic peptide corresponding to a sequence of human RECK (NAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIA).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for RECK

Target: RECK (Reversion-Inducing-Cysteine-Rich Protein with Kazal Motifs (RECK))

Alternative Name: RECK (RECK Products)

Synonyms: ST15 antibody, St15 antibody, mRECK antibody, reversion inducing cysteine rich protein with kazal motifs antibody, reversion-inducing-cysteine-rich protein with kazal motifs antibody, RECK antibody, Reck antibody

Background:

Synonyms: Reversion-inducing cysteine-rich protein with Kazal motifs, hRECK, Suppressor of tumorigenicity 15 protein, RECK, ST15

Tissue Specificity: Expressed in various tissues and untransformed cells. It is undetectable in tumor-derived cell lines and oncogenically transformed cells.

Background: Reversion-inducing-cysteine-rich protein with kazal motifs, also known as RECK, is a human gene, thought to be a metastasis suppressor. The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. Several transcript variants encoding different isoforms have been found for this gene.

UniProt: O95980