PSMA3 antibody (AA 88-127)

Catalog No. ABIN5708104

Product Details anti-PSMA3 Antibody

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Binding Specificity: AA 88-127

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 88-127 (LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS) from the human protein were used as the immunogen for the PSMA3 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PSMA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PSMA3

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Alternative Name: PSMA3 (PSMA3 Products)

Synonyms: HC8 antibody, PSC3 antibody, Psma3l antibody, psma3 antibody, im:6909944 antibody, zgc:114044 antibody, Lmpc8 antibody, proteasome subunit alpha 3 antibody, proteasome subunit alpha 3 L homeolog antibody, proteasome (prosome, macropain) subunit, alpha type 3 antibody, PSMA3 antibody, Psma3 antibody, psma3.L antibody, psma3 antibody

Background: Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

UniProt: P25788

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA