STAR antibody

Catalog No. ABIN5708349

Product Details anti-STAR Antibody

Target: STAR (Steroidogenic Acute Regulatory Protein (STAR))

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAR antibody is un-conjugated

Application: Western Blotting (WB)

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogen: Amino acids EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD from the human protein were used as the immunogen for the StAR antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the StAR antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the StAR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for STAR

Target: STAR (Steroidogenic Acute Regulatory Protein (STAR))

Alternative Name: StAR / Steroidogenic acute regulatory protein (STAR Products)

Synonyms: STARD1 antibody, AV363654 antibody, D8Ertd419e antibody, star antibody, LOC100219165 antibody, StARD1 antibody, steroidogenic acute regulatory protein antibody, steroidogenic acute regulatory protein L homeolog antibody, STAR antibody, Star antibody, star antibody, star.L antibody

Background: The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.

UniProt: P49675

Pathways: Metabolism of Steroid Hormones and Vitamin D, Response to Growth Hormone Stimulus, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis