CEP68 antibody

Catalog No. ABIN5708411

Product Details anti-CEP68 Antibody

Target: CEP68 (Centrosomal Protein 68kDa (CEP68))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CEP68 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CEP68 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CEP68 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CEP68

Target: CEP68 (Centrosomal Protein 68kDa (CEP68))

Alternative Name: CEP68 (CEP68 Products)

Synonyms: RGD1309101 antibody, 6030463E10Rik antibody, AI481761 antibody, BC027174 antibody, Kiaa0582 antibody, KIAA0582 antibody, centrosomal protein 68 antibody, Cep68 antibody, CEP68 antibody

Background: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.

UniProt: Q76N32

Pathways: SARS-CoV-2 Protein Interactome