ERBB4 antibody

Catalog No. ABIN5708421

Product Details anti-ERBB4 Antibody

Target: ERBB4 (V-Erb-A erythroblastic Leukemia Viral Oncogene Homolog 4 (Avian) (ERBB4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERBB4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR from the human protein were used as the immunogen for the ERBB4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ERBB4 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ERBB4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ERBB4

Target: ERBB4 (V-Erb-A erythroblastic Leukemia Viral Oncogene Homolog 4 (Avian) (ERBB4))

Alternative Name: ERBB4 / HER4 (ERBB4 Products)

Synonyms: erbb4 antibody, si:ch211-227n20.1 antibody, Her4 antibody, c-erbB-4 antibody, HER4 antibody, p180erbB4 antibody, erb-b2 receptor tyrosine kinase 4 antibody, erb-b2 receptor tyrosine kinase 4a antibody, v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) antibody, erb-b2 receptor tyrosine kinase 4 L homeolog antibody, receptor tyrosine-protein kinase ErbB-4 antibody, ERBB4 antibody, erbb4a antibody, erbb4 antibody, erbb4.L antibody, Tsp_13582 antibody, Erbb4 antibody

Background: ERBB4 (V-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4) also known as ONCOGENE ERBB4 or HER4, is an enzyme that in humans is encoded by the ERBB4 gene. The HER4/ERBB4 gene is a member of the type I receptor tyrosine kinase subfamily that includes EGFR, ERBB2 and ERBB3. This gene is mapped on 2q34. ERBB4 is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domainbinding motif. Furthermore, ERBB4 is a transmembrane receptor tyrosine kinase that regulates cell proliferation and differentiation. After binding its ligand, heregulin, or activation of protein kinase C by TPA, the ERBB4 ectodomain is cleaved by a metalloprotease.

UniProt: Q15303

Pathways: RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway