KDM2A antibody

Catalog No. ABIN5708449

Product Details anti-KDM2A Antibody

Target: KDM2A (Lysine (K)-Specific Demethylase 2A (KDM2A))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KDM2A antibody is un-conjugated

Application: Western Blotting (WB)

Cross-Reactivity (Details): Expected species reactivity: Rat

Purification: Antigen affinity purified

Immunogen: Amino acids KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR from the human protein were used as the immunogen for the FBXL11 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FBXL11 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FBXL11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for KDM2A

Target: KDM2A (Lysine (K)-Specific Demethylase 2A (KDM2A))

Alternative Name: KDM2A / FBXL11 (KDM2A Products)

Synonyms: FBXL11 antibody, JHDM1A antibody, 100043628 antibody, 5530401A10Rik antibody, AA589516 antibody, AW536790 antibody, Cxxc8 antibody, Fbl11 antibody, Fbl7 antibody, Fbxl11 antibody, Gm4560 antibody, Jhdm1 antibody, Jhdm1a antibody, lalina antibody, KDM2A antibody, CXXC8 antibody, FBL11 antibody, FBL7 antibody, LILINA antibody, fb76b11 antibody, wu:fb76b11 antibody, wu:fj11c04 antibody, zgc:158441 antibody, zgc:158606 antibody, lysine demethylase 2A antibody, lysine (K)-specific demethylase 2A antibody, lysine (K)-specific demethylase 2Aa antibody, KDM2A antibody, Kdm2a antibody, kdm2aa antibody

Background: Lysine-specific demethylase 2A (KDM2A) also known as F-box and leucine-rich repeat protein 11 (FBXL11) is an enzyme that in humans is encoded by the KDM2A gene. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least six highly degenerated leucine-rich repeats. This family member plays a role in epigenetic silencing. It nucleates at CpG islands and specifically demethylates both mono- and di-methylated lysine-36 of histone H3. Alternative splicing results in multiple transcript variants.

UniProt: Q9Y2K7

Pathways: Warburg Effect