FZD3 antibody
-
- Target See all FZD3 Antibodies
- FZD3 (Frizzled Family Receptor 3 (FZD3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FZD3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL from the human protein were used as the immunogen for the FZD3 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product FZD3 Primary Antibody
-
anti-Frizzled Family Receptor 3 (FZD3) (AA 121-220) antibody
FZD3 Reactivity: Human, Mouse, Rat, Xenopus laevis WB, ELISA, IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (AA 23-205) antibodyFZD3 Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (N-Term) antibodyFZD3 Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Chicken, Hamster, Horse, Monkey, Rabbit, Bat IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (AA 55-157) antibodyFZD3 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 1B8 unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (AA 55-157) antibodyFZD3 Reactivity: Human WB, ELISA, IF Host: Mouse Monoclonal 2H5 unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (Internal Region) antibodyFZD3 Reactivity: Human WB, ELISA, IF Host: Rabbit Polyclonal unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (AA 55-157) antibodyFZD3 Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (AA 1-62) antibodyFZD3 Reactivity: Human, Mouse WB Host: Rabbit Polyclonal unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (AA 581-596), (C-Term), (Extracellular) antibodyFZD3 Reactivity: Human, Mouse, Rat WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Frizzled Family Receptor 3 (FZD3) (AA 496-525), (C-Term) antibodyFZD3 Reactivity: Human WB Host: Rabbit Polyclonal RB37407 unconjugated
-
- Application Notes
- Optimal dilution of the FZD3 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the FZD3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- FZD3 (Frizzled Family Receptor 3 (FZD3))
- Alternative Name
- FZD3 / Frizzled 3 (FZD3 Products)
- Synonyms
- Fz-3 antibody, FZ-3 antibody, fz3 antibody, Xfz3 antibody, frz3 antibody, hfz3 antibody, frz-3 antibody, frizzled3 antibody, frizzled-3 antibody, FZD3 antibody, AU020229 antibody, D930050A07Rik antibody, Fz3 antibody, fz9 antibody, fzd3 antibody, zg09 antibody, fzd3l antibody, frizzled class receptor 3 antibody, frizzled class receptor 3 L homeolog antibody, frizzled class receptor 3a antibody, frizzled class receptor 3b antibody, FZD3 antibody, fzd3 antibody, fzd3.L antibody, Fzd3 antibody, fzd3a antibody, fzd3b antibody
- Background
- Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.
- UniProt
- Q9NPG1
- Pathways
- WNT Signaling, Tube Formation
-
