Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Acetyl-CoA Carboxylase beta antibody (ACACB) Primary Antibody

ACACB Reactivity: Human IHC (p), WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5774377
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Acetyl-CoA Carboxylase beta (ACACB)
    Reactivity
    Human
    • 35
    • 9
    • 2
    • 1
    Host
    Rabbit
    • 26
    • 10
    • 1
    Clonality
    Polyclonal
    • 36
    • 1
    Conjugate
    This Acetyl-CoA Carboxylase beta antibody is un-conjugated
    • 10
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    • 14
    • 13
    • 10
    • 4
    • 4
    • 2
    • 2
    • 1
    • 1
    Purpose
    Rabbit polyclonal antibody raised against partial recombinant human ACACB.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to human ACACB.

    Immunogen Sequence: ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    Acetyl-CoA Carboxylase beta (ACACB)
    Alternative Name
    ACACB (ACACB Antibody Abstract)
    Synonyms
    F15C21.2, F15C21_2, acetyl-CoA carboxylase 2, ACC2, ACCB, HACC275, Acc2, AI597064, AW743042, Accb, acetyl-CoA carboxylase 2, acetyl-CoA carboxylase beta, acetyl-Coenzyme A carboxylase beta, ACC2, ACACB, Acacb
    Background
    Full Gene Name: acetyl-Coenzyme A carboxylase beta
    Synonyms: ACC2,ACCB,HACC275
    Gene ID
    32
    UniProt
    O00763
    Pathways
    AMPK Signaling, Ribonucleoside Biosynthetic Process
You are here:
help Support