NR5A1 antibody (Middle Region)
-
- Target See all NR5A1 Antibodies
- NR5A1 (Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR5A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR5 A1 antibody was raised against the middle region of NR5 1
- Purification
- Purified
- Immunogen
- NR5 A1 antibody was raised using the middle region of NR5 1 corresponding to a region with amino acids LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA
- Top Product
- Discover our top product NR5A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR5A1 Blocking Peptide, catalog no. 33R-5322, is also available for use as a blocking control in assays to test for specificity of this NR5A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR5A1 (Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1))
- Alternative Name
- NR5A1 (NR5A1 Products)
- Synonyms
- AD4BP antibody, ELP antibody, FTZ1 antibody, FTZF1 antibody, POF7 antibody, SF-1 antibody, SF1 antibody, SPGF8 antibody, SRXY3 antibody, Ad4BP antibody, ELP-3 antibody, Ftz-F1 antibody, Ftzf1 antibody, Ad4BP/SF-1 antibody, Ad4bp antibody, Sf-1 antibody, NR5A1 antibody, sf-1 antibody, elp antibody, sf1 antibody, ftz1 antibody, ad4bp antibody, ftzf1 antibody, SF-1/Ad4BP antibody, SI:zC167P9.2 antibody, ff1d antibody, nr5a2l antibody, nuclear receptor subfamily 5 group A member 1 antibody, nuclear receptor subfamily 5, group A, member 1 antibody, nuclear receptor subfamily 5 group A member 1 L homeolog antibody, nuclear receptor subfamily 6 group A member 1 antibody, nuclear receptor subfamily 5, group A, member 1b antibody, NR5A1 antibody, Nr5a1 antibody, nr5a1.L antibody, nr5a1 antibody, NR6A1 antibody, nr5a1b antibody
- Background
- NR5A1 is an important regulator of steroidogeneis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Maintenance of Protein Location
-