NR1H2 antibody (Middle Region)

Catalog No. ABIN629580

Product Details anti-NR1H2 Antibody

Target: NR1H2 (Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR1H2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NR1 H2 antibody was raised against the middle region of NR1 2

Purification: Purified

Immunogen: NR1 H2 antibody was raised using the middle region of NR1 2 corresponding to a region with amino acids MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR1H2 Blocking Peptide, catalog no. 33R-6119, is also available for use as a blocking control in assays to test for specificity of this NR1H2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR1H2

Target: NR1H2 (Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2))

Alternative Name: NR1H2 (NR1H2 Products)

Synonyms: NR1H2 antibody, lxr-b antibody, lxrb antibody, ner antibody, ner-i antibody, rip15 antibody, unr antibody, DKFZp468A0622 antibody, AI194859 antibody, LXR antibody, LXRB antibody, LXRbeta antibody, NER1 antibody, OR-1 antibody, RIP15 antibody, UR antibody, Unr antibody, Unr2 antibody, LXR-b antibody, NER antibody, NER-I antibody, UNR antibody, nuclear receptor subfamily 1 group H member 2 antibody, nuclear receptor subfamily 1, group H, member 2 antibody, nuclear receptor subfamily 1 group H member 2 L homeolog antibody, NR1H2 antibody, nr1h2 antibody, Nr1h2 antibody, nr1h2.L antibody

Background: The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Nuclear Hormone Receptor Binding