PEBP1 antibody (C-Term)

Catalog No. ABIN629609

Product Details anti-PEBP1 Antibody

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PEBP1 antibody was raised against the C terminal of PEBP1

Purification: Purified

Immunogen: PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEBP1

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Alternative Name: PEBP1 (PEBP1 Products)

Synonyms: HCNP antibody, HCNPpp antibody, PBP antibody, PEBP antibody, PEBP-1 antibody, RKIP antibody, pbp antibody, hcnp antibody, pebp antibody, rkip antibody, Pbp antibody, Pbp1 antibody, Pbpr antibody, Rkip antibody, PEBP1 antibody, BcDNA:LP12095 antibody, CG18594 antibody, Dmel\\CG18594 antibody, T2 antibody, zgc:56033 antibody, zgc:76942 antibody, phosphatidylethanolamine binding protein 1 antibody, phosphatidylethanolamine binding protein 1 L homeolog antibody, phosphatidylethanolamine-binding protein antibody, phosphatidylethanolamine-binding protein,putative antibody, Phosphatidylethanolamine-binding protein 1 antibody, PEBP1 antibody, pebp1 antibody, Pebp1 antibody, pebp1.L antibody, RR_RS07785 antibody, PVX_235290 antibody, PVX_123630 antibody, PKH_143640 antibody, EAM_1207 antibody

Background: PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Feeding Behaviour