UBE2L3 antibody (C-Term)
-
- Target See all UBE2L3 Antibodies
- UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE2L3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- UBE2 L3 antibody was raised against the C terminal of UBE2 3
- Purification
- Purified
- Immunogen
- UBE2 L3 antibody was raised using the C terminal of UBE2 3 corresponding to a region with amino acids TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK
- Top Product
- Discover our top product UBE2L3 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE2L3 Blocking Peptide, catalog no. 33R-9017, is also available for use as a blocking control in assays to test for specificity of this UBE2L3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))
- Alternative Name
- UBE2L3 (UBE2L3 Products)
- Synonyms
- E2-F1 antibody, L-UBC antibody, UBCH7 antibody, UbcM4 antibody, C79827 antibody, Ubce7 antibody, ube2l3 antibody, wu:fc22h11 antibody, zgc:86727 antibody, UBE2L3 antibody, ube2l3l antibody, wu:fb38h03 antibody, ubiquitin conjugating enzyme E2 L3 antibody, ubiquitin-conjugating enzyme E2L 3 antibody, ubiquitin-conjugating enzyme E2L 3a antibody, ubiquitin conjugating enzyme E2 L3 S homeolog antibody, ubiquitin-conjugating enzyme E2L 3b antibody, UBE2L3 antibody, Ube2l3 antibody, ube2l3a antibody, ube2l3.S antibody, ube2l3b antibody
- Background
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro.
- Molecular Weight
- 75 kDa (MW of target protein)
-