SETD7 antibody

Catalog No. ABIN629619

Product Details anti-SETD7 Antibody

Target: SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SETD7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: SETD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SETD7 Blocking Peptide, catalog no. 33R-7322, is also available for use as a blocking control in assays to test for specificity of this SETD7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SETD7

Target: SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))

Alternative Name: SETD7 (SETD7 Products)

Synonyms: KMT7 antibody, SET7 antibody, SET7/9 antibody, SET9 antibody, set7 antibody, zgc:101860 antibody, zgc:92330 antibody, 1600028F23Rik antibody, H3K4MT antibody, Set7 antibody, Set7/9 antibody, mKIAA1717 antibody, SET domain containing lysine methyltransferase 7 antibody, SET domain containing (lysine methyltransferase) 7 antibody, SETD7 antibody, setd7 antibody, Setd7 antibody

Background: SETD7 is a histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It plays a central role in the transcriptional activation of genes such as collagenase or insulin. It is recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. It has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins.

Molecular Weight: 41 kDa (MW of target protein)