Pyrophosphatase (Inorganic) 1 (PPA1) antibody

Catalog No. ABIN629633

Product Details

Target: Pyrophosphatase (Inorganic) 1 (PPA1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PPA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPA1 Blocking Peptide, catalog no. 33R-7346, is also available for use as a blocking control in assays to test for specificity of this PPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Pyrophosphatase (Inorganic) 1 (PPA1)

Alternative Name: PPA1 (PPA1 Products)

Synonyms: ppa antibody, SCE9.16 antibody, PSPTO0722 antibody, AO090005001437 antibody, IOPPP antibody, PP antibody, PP1 antibody, SID6-8061 antibody, 2010317E03Rik antibody, Pyp antibody, Pp antibody, inorganic pyrophosphatase antibody, Inorganic pyrophosphatase antibody, pyrophosphatase (inorganic) 1 L homeolog antibody, pyrophosphatase (inorganic) 1 antibody, ppa antibody, SCO3409 antibody, ppa-1 antibody, APE_1692.1 antibody, AOR_1_2492174 antibody, Celal_2154 antibody, Celly_1958 antibody, Dester_1338 antibody, Marky_0054 antibody, Halhy_5834 antibody, ppa1.L antibody, PPA1 antibody, Ppa1 antibody

Target Type: Viral Protein

Background: PPA1 is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.

Molecular Weight: 33 kDa (MW of target protein)