Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1) (Middle Region) antibody

Details for Product No. ABIN629671, Supplier: Log in to see
Antigen
  • SCEH
  • cOR6not
  • fj55e05
  • si:zc217g15.1
  • wu:fj55e05
  • C80529
  • enoyl-CoA hydratase, short chain, 1, mitochondrial L homeolog
  • enoyl-CoA hydratase, short chain 1
  • enoyl CoA hydratase, short chain, 1, mitochondrial
  • enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
  • echs1.L
  • ECHS1
  • Echs1
  • echs1
Alternatives
anti-Cow (Bovine) Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial antibody for Western Blotting
Epitope
Middle Region
8
6
5
3
2
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
67
40
39
6
5
5
5
4
4
2
2
1
1
1
Host
Rabbit
57
10
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
43
22
19
14
8
7
4
4
3
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen ECHS1 antibody was raised using the middle region of ECHS1 corresponding to a region with amino acids RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA
Specificity ECHS1 antibody was raised against the middle region of ECHS1
Purification Purified
Antigen
Alternative Name ECHS1 (ECHS1 Antibody Abstract)
Background ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.
Molecular Weight 28 kDa (MW of target protein)
Pathways Monocarboxylic Acid Catabolic Process
Application Notes WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ECHS1 Blocking Peptide, catalog no. 33R-7826, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHS1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Western Blotting (WB) image for anti-Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1) (Middle Region) antibody (ABIN629671) ECHS1 antibody used at 2.5 ug/ml to detect target protein.
Did you look for something else?