ATP5B antibody (N-Term)

Catalog No. ABIN629672

Product Details anti-ATP5B Antibody

Target: ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP5B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ATP5 B antibody was raised against the N terminal of ATP5

Purification: Purified

Immunogen: ATP5 B antibody was raised using the N terminal of ATP5 corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP5B Blocking Peptide, catalog no. 33R-7154, is also available for use as a blocking control in assays to test for specificity of this ATP5B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP5B

Target: ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))

Alternative Name: ATP5B (ATP5B Products)

Synonyms: atpmb antibody, atpsb antibody, Atpsyn-beta antibody, hm:zehn0534 antibody, im:6793121 antibody, wu:fj38d01 antibody, zgc:111961 antibody, ATPMB antibody, ATPSB antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide antibody, ATP synthase subunit beta, mitochondrial antibody, ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide S homeolog antibody, ATP5B antibody, atp5b antibody, Atp5b antibody, LOC100401662 antibody, LOC100635763 antibody, atp5b.S antibody

Background: ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process