CROT antibody (N-Term)

Catalog No. ABIN629682

Product Details anti-CROT Antibody

Target: CROT (Carnitine O-Octanoyltransferase (CROT))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CROT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CROT antibody was raised against the N terminal of CROT

Purification: Purified

Immunogen: CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CROT Blocking Peptide, catalog no. 33R-5938, is also available for use as a blocking control in assays to test for specificity of this CROT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CROT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CROT

Target: CROT (Carnitine O-Octanoyltransferase (CROT))

Alternative Name: CROT (CROT Products)

Synonyms: CROT antibody, cot antibody, zgc:110643 antibody, COT antibody, 1200003H03Rik antibody, carnitine O-octanoyltransferase antibody, CROT antibody, crot antibody, Crot antibody

Background: Carnitine octanoyltransferase is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process