AADAT antibody (N-Term)

Catalog No. ABIN629693

Product Details anti-AADAT Antibody

Target: AADAT (Aminoadipate Aminotransferase (AADAT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AADAT antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: AADAT antibody was raised against the N terminal of AADAT

Purification: Purified

Immunogen: AADAT antibody was raised using the N terminal of AADAT corresponding to a region with amino acids AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AADAT Blocking Peptide, catalog no. 33R-1601, is also available for use as a blocking control in assays to test for specificity of this AADAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AADAT

Target: AADAT (Aminoadipate Aminotransferase (AADAT))

Alternative Name: AADAT (AADAT Products)

Synonyms: KAT2 antibody, KATII antibody, AI875679 antibody, Aadt antibody, Kat2 antibody, mKat-2 antibody, MGC80030 antibody, kat2 antibody, katii antibody, aminoadipate aminotransferase antibody, aminoadipate aminotransferase S homeolog antibody, AADAT antibody, Aadat antibody, aadat.S antibody, aadat antibody

Background: AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties.

Molecular Weight: 47 kDa (MW of target protein)