METTL1 antibody (Middle Region)

Catalog No. ABIN629728

Product Details anti-METTL1 Antibody

Target: METTL1 (Methyltransferase Like 1 (METTL1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: METTL1 antibody was raised against the middle region of METTL1

Purification: Purified

Immunogen: METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL1 Blocking Peptide, catalog no. 33R-4401, is also available for use as a blocking control in assays to test for specificity of this METTL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL1

Target: METTL1 (Methyltransferase Like 1 (METTL1))

Alternative Name: METTL1 (METTL1 Products)

Synonyms: Dmel\\CG4045 antibody, EG:22E5.4 antibody, C12orf1 antibody, TRM8 antibody, TRMT8 antibody, YDL201w antibody, 2810012D02Rik antibody, CG4045 gene product from transcript CG4045-RA antibody, methyltransferase like 1 antibody, methyltransferase like 1 L homeolog antibody, tRNA (guanine46-N7)-methyltransferase antibody, tRNA (guanine-N(1)-)-methyltransferase antibody, tRNA (guanine-N7-)-methyltransferase antibody, CG4045 antibody, METTL1 antibody, Mettl1 antibody, mettl1.L antibody, CAALFM_C404810CA antibody, LOC100280508 antibody, LOC732983 antibody

Background: METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.

Molecular Weight: 34 kDa (MW of target protein)