RBCK1 antibody (Middle Region)

Catalog No. ABIN629734

Product Details anti-RBCK1 Antibody

Target: RBCK1 (RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBCK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C20 ORF18 antibody was raised against the middle region of C20 rf18

Purification: Purified

Immunogen: C20 ORF18 antibody was raised using the middle region of C20 rf18 corresponding to a region with amino acids AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF18 Blocking Peptide, catalog no. 33R-1633, is also available for use as a blocking control in assays to test for specificity of this C20ORF18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBCK1

Target: RBCK1 (RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1))

Alternative Name: C20ORF18 (RBCK1 Products)

Synonyms: RBCK1 antibody, C20orf18 antibody, HOIL-1 antibody, HOIL1 antibody, RBCK2 antibody, RNF54 antibody, UBCE7IP3 antibody, XAP3 antibody, XAP4 antibody, ZRANB4 antibody, C20ORF18 antibody, AL033326 antibody, HOIL-1L antibody, UIP28 antibody, Ubce7ip3 antibody, Pkcbpb15 antibody, zgc:91964 antibody, SHANK-associated RH domain interactor antibody, RANBP2-type and C3HC4-type zinc finger containing 1 antibody, ranBP-type and C3HC4-type zinc finger-containing protein 1 antibody, RanBP-type and C3HC4-type zinc finger containing 1 antibody, SHARPIN antibody, RBCK1 antibody, LOC100411512 antibody, Rbck1 antibody, rbck1 antibody

Background: C20orf18 is similar to mouse UIP28/UbcM4 interacting protein.

Molecular Weight: 51 kDa (MW of target protein)