TRMT2B antibody (Middle Region)

Catalog No. ABIN629778

Product Details anti-TRMT2B Antibody

Target: TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRMT2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CXORF34 antibody was raised against the middle region of Cxorf34

Purification: Purified

Immunogen: CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CXORF34 Blocking Peptide, catalog no. 33R-3146, is also available for use as a blocking control in assays to test for specificity of this CXORF34 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRMT2B

Target: TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))

Alternative Name: CXORF34 (TRMT2B Products)

Synonyms: CXorf34 antibody, dJ341D10.3 antibody, 4732479N06Rik antibody, im:7160396 antibody, wu:fc49d02 antibody, zgc:162982 antibody, tRNA methyltransferase 2 homolog B antibody, TRM2 tRNA methyltransferase 2B antibody, TRMT2B antibody, Trmt2b antibody, trmt2b antibody

Background: CXorf34 is a putative methyltransferase.

Molecular Weight: 56 kDa (MW of target protein)