NAA50 antibody (C-Term)

Catalog No. ABIN629779

Product Details anti-NAA50 Antibody

Target: NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAA50 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NAT13 antibody was raised against the C terminal of NAT13

Purification: Purified

Immunogen: NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAT13 Blocking Peptide, catalog no. 33R-1262, is also available for use as a blocking control in assays to test for specificity of this NAT13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAA50

Target: NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))

Alternative Name: NAT13 (NAA50 Products)

Synonyms: MAK3 antibody, NAT13 antibody, NAT5 antibody, SAN antibody, hNAT5 antibody, hSAN antibody, 2600005K24Rik antibody, 2810441M03Rik antibody, AW112078 antibody, Mak3 antibody, Mak3p antibody, Nat13 antibody, Nat5 antibody, San antibody, DKFZp469M1032 antibody, san antibody, mak3 antibody, nat5 antibody, nat13 antibody, MGC80671 antibody, N(alpha)-acetyltransferase 50, NatE catalytic subunit antibody, N(alpha)-acetyltransferase 50, NatE catalytic subunit L homeolog antibody, NAA50 antibody, Naa50 antibody, naa50.L antibody

Background: NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.

Molecular Weight: 19 kDa (MW of target protein)