ENO3 antibody
-
- Target See all ENO3 Antibodies
- ENO3 (Enolase 3 (Beta, Muscle) (ENO3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ENO3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- Enolase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR
- Top Product
- Discover our top product ENO3 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Enolase 3 Blocking Peptide, catalog no. 33R-5704, is also available for use as a blocking control in assays to test for specificity of this Enolase 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENO3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ENO3 (Enolase 3 (Beta, Muscle) (ENO3))
- Alternative Name
- Enolase 3 (ENO3 Products)
- Synonyms
- ENO3 antibody, GSD13 antibody, MSE antibody, ENO1 antibody, cb883 antibody, fj24f12 antibody, wu:fj24f12 antibody, Eno-3 antibody, BBE antibody, enolase 3 (beta, muscle) L homeolog antibody, enolase 3 antibody, enolase 3 (beta, muscle) antibody, enolase 3, (beta, muscle) antibody, enolase 3, beta muscle antibody, eno3.L antibody, ENO3 antibody, eno3 antibody, Eno3 antibody
- Background
- ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.
- Molecular Weight
- 47 kDa (MW of target protein)
-