CEACAM6 antibody
-
- Target See all CEACAM6 Antibodies
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CEACAM6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
- Top Product
- Discover our top product CEACAM6 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CEACAM6 Blocking Peptide, catalog no. 33R-2483, is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
- Alternative Name
- CEACAM6 (CEACAM6 Products)
- Synonyms
- CD66c antibody, CEAL antibody, NCA antibody, carcinoembryonic antigen-related cell adhesion molecule 6 antibody, carcinoembryonic antigen related cell adhesion molecule 6 antibody, Ceacam6 antibody, CEACAM6 antibody
- Background
- Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
- Molecular Weight
- 38 kDa (MW of target protein)
-