ADH6 antibody

Catalog No. ABIN629805

Product Details anti-ADH6 Antibody

Target: ADH6 (Alcohol Dehydrogenase 6 (Class V) (ADH6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADH6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: ADH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADH6 Blocking Peptide, catalog no. 33R-1184, is also available for use as a blocking control in assays to test for specificity of this ADH6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADH6

Target: ADH6 (Alcohol Dehydrogenase 6 (Class V) (ADH6))

Alternative Name: ADH6 (ADH6 Products)

Synonyms: ADH1A antibody, ADH1B antibody, ADH-5 antibody, alcohol dehydrogenase 6 (class V) antibody, ADH6 antibody, Adh6 antibody

Background: ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.

Molecular Weight: 32 kDa (MW of target protein)