PUS7 antibody

Catalog No. ABIN629814

Product Details anti-PUS7 Antibody

Target: PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PUS7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PUS7 Blocking Peptide, catalog no. 33R-2838, is also available for use as a blocking control in assays to test for specificity of this PUS7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PUS7

Target: PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))

Alternative Name: PUS7 (PUS7 Products)

Synonyms: C330017I15Rik antibody, RGD1307054 antibody, pseudouridylate synthase 7 (putative) antibody, pseudouridylate synthase 7 homolog antibody, pseudouridylate synthase 7 (putative) L homeolog antibody, pseudouridylate synthase 7 homolog (S. cerevisiae) antibody, pseudouridylate synthase 7 antibody, PUS7 antibody, LOC100449507 antibody, pus7 antibody, pus7.L antibody, Pus7 antibody

Background: PUS7 is involved in RNA binding, pseudouridine synthase activity and isomerase activity.

Molecular Weight: 75 kDa (MW of target protein)