PFKL antibody (Middle Region)

Catalog No. ABIN629821

Product Details anti-PFKL Antibody

Target: PFKL (Phosphofructokinase, Liver (PFKL))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PFKL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PFKL antibody was raised against the middle region of PFKL

Purification: Purified

Immunogen: PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PFKL Blocking Peptide, catalog no. 33R-8233, is also available for use as a blocking control in assays to test for specificity of this PFKL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PFKL

Target: PFKL (Phosphofructokinase, Liver (PFKL))

Alternative Name: PFKL (PFKL Products)

Synonyms: PFK-B antibody, AA407869 antibody, phosphofructokinase, liver type antibody, phosphofructokinase, liver, B-type antibody, PFKL antibody, Pfkl antibody

Background: Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Warburg Effect