14-3-3 zeta antibody (C-Term)

Catalog No. ABIN629824

Product Details anti-14-3-3 zeta Antibody

Target: 14-3-3 zeta (YWHAZ)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This 14-3-3 zeta antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: YWHAZ antibody was raised against the C terminal of YWHAZ

Purification: Purified

Immunogen: YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YWHAZ Blocking Peptide, catalog no. 33R-1158, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for 14-3-3 zeta

Target: 14-3-3 zeta (YWHAZ)

Alternative Name: YWHAZ (YWHAZ Products)

Synonyms: 14-3-3-zeta antibody, KCIP-1 antibody, YWHAD antibody, 14-3-3zeta antibody, Ywhaz antibody, ACYPI003154 antibody, 14-3-3z antibody, kcip-1 antibody, ywhaq antibody, 1433z antibody, ywhaz antibody, ywhazb antibody, 1110013I11Rik antibody, AI596267 antibody, AL022924 antibody, AU020854 antibody, ywhaza antibody, fb14h09 antibody, wu:fb05g08 antibody, wu:fb14h09 antibody, ywhai antibody, zgc:55807 antibody, 14-3-3 antibody, 14-3-3 zeta antibody, 14-3-3ZETA antibody, 14-3-3leo antibody, 2G1 antibody, 4-3-3 zeta antibody, 5.11 antibody, 549 antibody, BEST:GH05075 antibody, CG17870 antibody, D14-3-3 antibody, D14-3-3zeta antibody, Dmel\\CG17870 antibody, K antibody, LEO antibody, Leo antibody, PAR-5 antibody, PAR5 antibody, Par-5 antibody, d14-3-3zeta antibody, l(2)07103 antibody, l(2)46CFe antibody, l(2)46Ee antibody, leo antibody, par-5 antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antibody, 14-3-3 protein zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antibody, 14-3-3 protein zeta/delta pseudogene antibody, CG17870 gene product from transcript CG17870-RE antibody, YWHAZ antibody, 14-3-3zeta antibody, ywhaz antibody, 1433z antibody, ywhaz.L antibody, Ywhaz antibody, ywhaz.S antibody, LOC100855903 antibody

Background: YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location