NUDT16L1 antibody

Catalog No. ABIN629838

Product Details anti-NUDT16L1 Antibody

Target: NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUDT16L1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: NUDT16 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUDT16L1 Blocking Peptide, catalog no. 33R-3430, is also available for use as a blocking control in assays to test for specificity of this NUDT16L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUDT16L1

Target: NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))

Alternative Name: NUDT16L1 (NUDT16L1 Products)

Synonyms: SDOS antibody, 1110001K21Rik antibody, 5330437I08Rik antibody, Sdos antibody, nudix hydrolase 16 like 1 antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 antibody, NUDT16L1 antibody, Nudt16l1 antibody

Background: NUDT16L1 is a probable adapter protein, which may link syndecan-4 (SDC4) and paxilin (TGFB1I1 and PXN) receptors.

Molecular Weight: 23 kDa (MW of target protein)