NUDT16L1 antibody
-
- Target See all NUDT16L1 Antibodies
- NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUDT16L1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- NUDT16 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE
- Top Product
- Discover our top product NUDT16L1 Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUDT16L1 Blocking Peptide, catalog no. 33R-3430, is also available for use as a blocking control in assays to test for specificity of this NUDT16L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))
- Alternative Name
- NUDT16L1 (NUDT16L1 Products)
- Synonyms
- SDOS antibody, 1110001K21Rik antibody, 5330437I08Rik antibody, Sdos antibody, nudix hydrolase 16 like 1 antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 antibody, NUDT16L1 antibody, Nudt16l1 antibody
- Background
- NUDT16L1 is a probable adapter protein, which may link syndecan-4 (SDC4) and paxilin (TGFB1I1 and PXN) receptors.
- Molecular Weight
- 23 kDa (MW of target protein)
-