Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) antibody

Catalog No. ABIN629855

Product Details

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: C6 ORF134 antibody was raised against the N terminal Of C6 rf134

Purification: Purified

Immunogen: C6 ORF134 antibody was raised using the N terminal Of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF134 Blocking Peptide, catalog no. 33R-5915, is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF134 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Alternative Name: C6ORF134 (C6orf134 Products)

Synonyms: C6orf134 antibody, MEC17 antibody, Nbla00487 antibody, TAT antibody, mec17 antibody, wu:fj19c03 antibody, zgc:65893 antibody, zgc:77443 antibody, Alpha-TAT antibody, c6orf134 antibody, C23H6orf134 antibody, 0610011P08Rik antibody, 2610008K08Rik antibody, 2610110G12Rik antibody, 3110080J08Rik antibody, Mec17 antibody, RGD1303066 antibody, C7H6ORF134 antibody, C4H6orf134 antibody, alpha tubulin acetyltransferase 1 antibody, alpha tubulin acetyltransferase 1 S homeolog antibody, ATAT1 antibody, atat1 antibody, atat1.S antibody, Atat1 antibody

Background: The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 36 kDa (MW of target protein)