ATIC antibody (Middle Region)

Catalog No. ABIN629868

Product Details anti-ATIC Antibody

Target: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATIC antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ATIC antibody was raised against the middle region of ATIC

Purification: Purified

Immunogen: ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATIC Blocking Peptide, catalog no. 33R-8229, is also available for use as a blocking control in assays to test for specificity of this ATIC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATIC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATIC

Target: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Alternative Name: ATIC (ATIC Products)

Synonyms: AICAR antibody, AICARFT antibody, IMPCHASE antibody, PURH antibody, purH antibody, 2610509C24Rik antibody, AA536954 antibody, AW212393 antibody, 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase L homeolog antibody, bifunctional purine biosynthesis protein PurH antibody, bifunctional purine biosynthesis protein purH antibody, Bifunctional purine biosynthesis protein purH antibody, Bifunctional purine biosynthesis protein PurH antibody, 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase antibody, atic.L antibody, purH antibody, ATIC antibody, Atic antibody

Background: ATIC is a bifunctional protein requiring dimerization for transformylase activity.

Molecular Weight: 30 kDa (MW of target protein)