MMP19 antibody (C-Term)
-
- Target See all MMP19 Antibodies
- MMP19 (Matrix Metallopeptidase 19 (MMP19))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMP19 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- MMP19 antibody was raised against the C terminal of MMP19
- Purification
- Purified
- Immunogen
- MMP19 antibody was raised using the C terminal of MMP19 corresponding to a region with amino acids IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS
- Top Product
- Discover our top product MMP19 Primary Antibody
-
-
- Application Notes
-
WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MMP19 Blocking Peptide, catalog no. 33R-3981, is also available for use as a blocking control in assays to test for specificity of this MMP19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMP19 (Matrix Metallopeptidase 19 (MMP19))
- Alternative Name
- MMP19 (MMP19 Products)
- Synonyms
- mmp18 antibody, mmp-18 antibody, mmp-19 antibody, col4 antibody, MMP18 antibody, RASI-1 antibody, matrix metallopeptidase 19 antibody, matrix metallopeptidase 1 S homeolog antibody, mmp19 antibody, mmp1.S antibody, MMP19 antibody, Mmp19 antibody
- Background
- Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of the protein encoded by this gene has not been determined. This gene was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19).
- Molecular Weight
- 56 kDa (MW of target protein)
-