SYNCRIP antibody (N-Term)

Catalog No. ABIN629882

Product Details anti-SYNCRIP Antibody

Target: SYNCRIP (Synaptotagmin Binding, Cytoplasmic RNA Interacting Protein (SYNCRIP))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYNCRIP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SYNCRIP antibody was raised against the N terminal of SYNCRIP

Purification: Purified

Immunogen: SYNCRIP antibody was raised using the N terminal of SYNCRIP corresponding to a region with amino acids MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SYNCRIP Blocking Peptide, catalog no. 33R-5770, is also available for use as a blocking control in assays to test for specificity of this SYNCRIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNCRIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SYNCRIP

Target: SYNCRIP (Synaptotagmin Binding, Cytoplasmic RNA Interacting Protein (SYNCRIP))

Alternative Name: SYNCRIP (SYNCRIP Products)

Synonyms: GRY-RBP antibody, GRYRBP antibody, HNRNPQ antibody, HNRPQ1 antibody, NSAP1 antibody, PP68 antibody, hnRNP-Q antibody, 2610109K23Rik antibody, 4632417O19Rik antibody, Nsap1 antibody, Nsap1l antibody, pp68 antibody, nsap1 antibody, wu:fe02c03 antibody, wu:fe47h09 antibody, SYNCRIP antibody, hnrpq1 antibody, gry-rbp antibody, rp1-3j17.2 antibody, synaptotagmin binding cytoplasmic RNA interacting protein antibody, synaptotagmin binding, cytoplasmic RNA interacting protein antibody, synaptotagmin binding cytoplasmic RNA interacting protein S homeolog antibody, SYNCRIP antibody, Syncrip antibody, syncrip antibody, syncrip.S antibody

Background: Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

Molecular Weight: 69 kDa (MW of target protein)