SRSF1 antibody

Catalog No. ABIN629883

Product Details anti-SRSF1 Antibody

Target: SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRSF1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS1 Blocking Peptide, catalog no. 33R-3658, is also available for use as a blocking control in assays to test for specificity of this SFRS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRSF1

Target: SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))

Alternative Name: SFRS1 (SRSF1 Products)

Synonyms: ASF antibody, SF2 antibody, SF2p33 antibody, SFRS1 antibody, SRp30a antibody, 1110054N12Rik antibody, 5730507C05Rik antibody, 6330415C05Rik antibody, AI482334 antibody, AW491331 antibody, Asf antibody, Sf2 antibody, Sfrs1 antibody, DKFZp469K2419 antibody, sfrs1 antibody, sfrs1b antibody, wu:fb80g05 antibody, zgc:111894 antibody, zgc:65898 antibody, zgc:76897 antibody, asf antibody, sf2 antibody, sf2p33 antibody, srp30a antibody, sfrs1a antibody, sfrs1l antibody, wu:fb52g10 antibody, wu:fb97g12 antibody, zgc:66146 antibody, serine and arginine rich splicing factor 1 antibody, serine/arginine-rich splicing factor 1 antibody, serine/arginine-rich splicing factor 1b antibody, serine/arginine-rich splicing factor 1 L homeolog antibody, serine/arginine-rich splicing factor 1a antibody, SRSF1 antibody, Srsf1 antibody, srsf1b antibody, srsf1.L antibody, srsf1a antibody

Background: SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization