RRP9 antibody (Middle Region)

Catalog No. ABIN629914

Product Details anti-RRP9 Antibody

Target: RRP9 (Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (RRP9))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRP9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RRP9 antibody was raised against the middle region of RRP9

Purification: Purified

Immunogen: RRP9 antibody was raised using the middle region of RRP9 corresponding to a region with amino acids IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRP9 Blocking Peptide, catalog no. 33R-4097, is also available for use as a blocking control in assays to test for specificity of this RRP9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRP9

Target: RRP9 (Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (RRP9))

Alternative Name: RRP9 (RRP9 Products)

Synonyms: Rnu3ip2 antibody, RNU3IP2 antibody, U3-55K antibody, 55kDa antibody, D19435 antibody, D9Wsu10e antibody, U3-55k antibody, ribosomal RNA processing 9, U3 small nucleolar RNA binding protein antibody, RRP9, small subunit (SSU) processome component, homolog (yeast) antibody, Rrp9 antibody, RRP9 antibody

Background: RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection