PSMA1 antibody

Catalog No. ABIN629944

Product Details anti-PSMA1 Antibody

Target: PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMA1 Blocking Peptide, catalog no. 33R-6001, is also available for use as a blocking control in assays to test for specificity of this PSMA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMA1

Target: PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))

Alternative Name: PSMA1 (PSMA1 Products)

Synonyms: PSMA1 antibody, pros30 antibody, DDBDRAFT_0204226 antibody, DDBDRAFT_0214956 antibody, DDB_0204226 antibody, DDB_0214956 antibody, C2 antibody, HC2 antibody, Pros-30 antibody, alpha-type antibody, NU antibody, PROS30 antibody, CC2 antibody, zgc:92726 antibody, 143314_at antibody, Alpha-6 antibody, CG4904 antibody, Dmel\CG4904 antibody, PROS-35 antibody, PROS-Dm35 antibody, Pros-35 antibody, Pros-Dm35 antibody, Prosalpha6 antibody, alpha6 antibody, alpha_dm antibody, anon-SAGE:Wang-116 antibody, pros 35 antibody, pros35 antibody, proteasome subunit alpha 1 antibody, proteasome subunit alpha type 1 antibody, 20S proteasome subunit C2 antibody, proteasome (prosome, macropain) subunit, alpha type 1 antibody, proteasome subunit alpha 1 L homeolog antibody, Proteasome alpha6 subunit antibody, PSMA1 antibody, psma1 antibody, CNB05540 antibody, psmA1 antibody, Psma1 antibody, psma1.L antibody, Prosalpha6 antibody

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA