APOBEC2 antibody (N-Term)

Catalog No. ABIN629998

Product Details anti-APOBEC2 Antibody

Target: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOBEC2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ApoBEC2 antibody was raised against the N terminal of APOBEC2

Purification: Purified

Immunogen: ApoBEC2 antibody was raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoBEC2 Blocking Peptide, catalog no. 33R-9438, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOBEC2

Target: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Alternative Name: ApoBEC2 (APOBEC2 Products)

Synonyms: MGC84761 antibody, arp1 antibody, arcd1 antibody, MGC89256 antibody, APOBEC2 antibody, DKFZp468H1727 antibody, Arp1 antibody, ARCD1 antibody, ARP1 antibody, apolipoprotein B mRNA editing enzyme catalytic subunit 2 antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 L homeolog antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2 antibody, APOBEC2 antibody, apobec2.L antibody, apobec2 antibody, Apobec2 antibody

Background: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.

Molecular Weight: 25 kDa (MW of target protein)