NUDT21 antibody

Catalog No. ABIN630019

Product Details anti-NUDT21 Antibody

Target: NUDT21 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUDT21 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: NUDT21 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUDT21 Blocking Peptide, catalog no. 33R-9098, is also available for use as a blocking control in assays to test for specificity of this NUDT21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUDT21

Target: NUDT21 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21))

Alternative Name: NUDT21 (NUDT21 Products)

Synonyms: CFIM25 antibody, CPSF5 antibody, 25kDa antibody, 3110048P04Rik antibody, 5730530J16Rik antibody, AU014860 antibody, AW549947 antibody, Cpsf5 antibody, zgc:63966 antibody, cpsf5 antibody, An16g01870 antibody, AO090003001316 antibody, Afu5g02030 antibody, T9L24.30 antibody, T9L24_30 antibody, atnudt21 antibody, nudix hydrolase homolog 21 antibody, nudix hydrolase 21 antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 21 antibody, nudix hydrolase 21 L homeolog antibody, cleavage and polyadenylation specificity factor subunit 5 antibody, cleavage and polyadenylation specific factor 5 antibody, autocrine motility factor receptor antibody, nudix hydrolase homolog 21 antibody, NUDT21 antibody, Nudt21 antibody, nudt21 antibody, nudt21.L antibody, ANI_1_1518144 antibody, AOR_1_2312154 antibody, PTRG_11035 antibody, PAAG_04662 antibody, MCYG_02022 antibody, VDBG_06706 antibody, MGYG_04057 antibody, cpsf5 antibody, PGTG_05353 antibody, Tsp_03672 antibody, LOC732888 antibody, AFUA_5G02030 antibody, NFIA_040090 antibody, ACLA_003240 antibody, CC1G_07993 antibody, PMAA_039710 antibody, AFLA_025180 antibody, TSTA_079060 antibody, BDBG_01565 antibody, TERG_04393 antibody

Background: NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.

Molecular Weight: 25 kDa (MW of target protein)