CPSF6 antibody (Middle Region)

Catalog No. ABIN630020

Product Details anti-CPSF6 Antibody

Target: CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPSF6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CPSF6 antibody was raised against the middle region of CPSF6

Purification: Purified

Immunogen: CPSF6 antibody was raised using the middle region of CPSF6 corresponding to a region with amino acids PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP

Application Details

Application Notes: WB: 0.3125 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPSF6 Blocking Peptide, catalog no. 33R-7262, is also available for use as a blocking control in assays to test for specificity of this CPSF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPSF6

Target: CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))

Alternative Name: CPSF6 (CPSF6 Products)

Synonyms: CPSF6 antibody, wu:fa22f12 antibody, zgc:85819 antibody, 4733401N12Rik antibody, AI256641 antibody, CFIM antibody, CFIM68 antibody, HPBRII-4 antibody, HPBRII-7 antibody, cleavage and polyadenylation specific factor 6 antibody, cleavage and polyadenylation specific factor 6 S homeolog antibody, CPSF6 antibody, cpsf6.S antibody, cpsf6 antibody, Cpsf6 antibody

Background: CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.

Molecular Weight: 61 kDa (MW of target protein)