RG9MTD2 antibody
-
- Target See all RG9MTD2 Antibodies
- RG9MTD2 (RNA (Guanine-9-) Methyltransferase Domain Containing 2 (RG9MTD2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RG9MTD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- RG9 MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
- Top Product
- Discover our top product RG9MTD2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RG9MTD2 Blocking Peptide, catalog no. 33R-2317, is also available for use as a blocking control in assays to test for specificity of this RG9MTD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RG9MTD2 (RNA (Guanine-9-) Methyltransferase Domain Containing 2 (RG9MTD2))
- Alternative Name
- RG9MTD2 (RG9MTD2 Products)
- Synonyms
- RG9MTD2 antibody, TRM10 antibody, Rg9mtd2 antibody, 3110023L08Rik antibody, AA794508 antibody, Rnmtd2 antibody, tRNA methyltransferase 10A antibody, tRNA methyltransferase 10A L homeolog antibody, TRMT10A antibody, trmt10a antibody, trmt10a.L antibody, Trmt10a antibody
- Background
- RG9MTD2 is a probable RNA methyltransferase.
- Molecular Weight
- 37 kDa (MW of target protein)
-