KCNN2 antibody (C-Term)
-
- Target See all KCNN2 Antibodies
- KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNN2 antibody was raised against the C terminal of KCNN2
- Purification
- Purified
- Immunogen
- KCNN2 antibody was raised using the C terminal of KCNN2 corresponding to a region with amino acids IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
- Top Product
- Discover our top product KCNN2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNN2 Blocking Peptide, catalog no. 33R-3914, is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))
- Alternative Name
- KCNN2 (KCNN2 Products)
- Synonyms
- KCNN2 antibody, SK2 antibody, KCa2.2 antibody, SKCA2 antibody, SKCa 2 antibody, hSK2 antibody, fri antibody, potassium calcium-activated channel subfamily N member 2 antibody, potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 antibody, KCNN2 antibody, Kcnn2 antibody
- Background
- Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.
- Molecular Weight
- 64 kDa (MW of target protein)
-