KCNA10 antibody (Middle Region)

Catalog No. ABIN630070

Product Details anti-KCNA10 Antibody

Target: KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNA10 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KCNA10 antibody was raised against the middle region of KCNA10

Purification: Purified

Immunogen: KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNA10 Blocking Peptide, catalog no. 33R-6970, is also available for use as a blocking control in assays to test for specificity of this KCNA10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNA10

Target: KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))

Alternative Name: KCNA10 (KCNA10 Products)

Synonyms: cKv1.2 antibody, Kcn1 antibody, Kv1.8 antibody, Gm1962 antibody, Kcna8 antibody, potassium voltage-gated channel subfamily A member 10 antibody, potassium voltage-gated channel, shaker-related subfamily, member 10 antibody, KCNA10 antibody, Kcna10 antibody

Background: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

Molecular Weight: 56 kDa (MW of target protein)