CLIC4 antibody (N-Term)

Catalog No. ABIN630071

Product Details anti-CLIC4 Antibody

Target: CLIC4 (Chloride Intracellular Channel 4 (CLIC4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLIC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CLIC4 antibody was raised against the N terminal of CLIC4

Purification: Purified

Immunogen: CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLIC4 Blocking Peptide, catalog no. 33R-5440, is also available for use as a blocking control in assays to test for specificity of this CLIC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLIC4

Target: CLIC4 (Chloride Intracellular Channel 4 (CLIC4))

Alternative Name: CLIC4 (CLIC4 Products)

Background: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIon Channel4) protein, encoded by the CLIon Channel4 gene, is a member of the p64 family, the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).

Molecular Weight: 28 kDa (MW of target protein)