CACNG6 antibody (N-Term)

Catalog No. ABIN630072

Product Details anti-CACNG6 Antibody

Target: CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACNG6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACNG6 antibody was raised against the N terminal of CACNG6

Purification: Purified

Immunogen: CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACNG6 Blocking Peptide, catalog no. 33R-7808, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACNG6

Target: CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))

Alternative Name: CACNG6 (CACNG6 Products)

Synonyms: CACNG6 antibody, cacng6 antibody, MGC122711 antibody, 2310033H20Rik antibody, AW050150 antibody, calcium voltage-gated channel auxiliary subunit gamma 6 antibody, calcium channel, voltage-dependent, gamma subunit 6 antibody, CACNG6 antibody, cacng6 antibody, Cacng6 antibody

Background: L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

Molecular Weight: 24 kDa (MW of target protein)