TRPM3 antibody (N-Term)
-
- Target See all TRPM3 Antibodies
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPM3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPM3 antibody was raised against the N terminal of TRPM3
- Purification
- Purified
- Immunogen
- TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK
- Top Product
- Discover our top product TRPM3 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPM3 Blocking Peptide, catalog no. 33R-10179, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
- Alternative Name
- TRPM3 (TRPM3 Products)
- Synonyms
- GON-2 antibody, LTRPC3 antibody, MLSN2 antibody, 6330504P12Rik antibody, 9330180E14 antibody, AU018608 antibody, B930001P07Rik antibody, si:dkey-201c13.4 antibody, trpm6 antibody, transient receptor potential cation channel subfamily M member 3 antibody, transient receptor potential cation channel, subfamily M, member 3 antibody, TRPM3 antibody, Trpm3 antibody, trpm3 antibody
- Background
- TRPM3 encodes a protein that belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The encoded protein mediates calcium entry, and this entry is potentiated by calcium store depletion.
- Molecular Weight
- 35 kDa (MW of target protein)
-